Overview

  • Product name
    Recombinant Human GRF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSK KGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVAS RSQRQKNLSW
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C3G
    • C3G protein
    • CRK SH3 binding GNRP
    • CRK SH3-binding GNRP
    • DKFZp781P1719
    • GRF 2
    • GRF2
    • Guanine nucleotide releasing factor 2
    • Guanine nucleotide releasing factor 2 (specific for crk proto oncogene)
    • Guanine nucleotide-releasing factor 2
    • OTTHUMP00000064558
    • Protein C3G
    • Rap guanine nucleotide exchange factor (GEF) 1
    • Rap guanine nucleotide exchange factor 1
    • RAPGEF 1
    • RAPGEF1
    • RPGF1_HUMAN
    see all
  • Function
    Guanine nucleotide-releasing protein that binds to SH3 domain of CRK and GRB2/ASH. Transduces signals from CRK to activate RAS.
  • Tissue specificity
    Ubiquitously expressed in adult and fetus. Expression is high in adult skeletal muscle and placenta and in fetal brain and heart. Low levels of expression in adult and fetal liver.
  • Sequence similarities
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-GEF domain.
  • Information by UniProt

Images

  • ab158579 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up