Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKA MMSINGDEDSAAALGLLYDYYKVPRDKRLLSVSKASDSQEDQEKRNCLGT SEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAII PVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATH SAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQY TLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVV MVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEI AYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNN RSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGKGQASQTQCNSSS DGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQRTGQVYYNT DDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLLYVRKETDDVF DALMLKSPTVKGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEH YSNEDTFILNMESMVEGFKVTLMEI
    • Amino acids
      1 to 625
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BOM
    • Brother of mammalian grainyhead
    • Deafness autosomal dominant 28
    • DFNA28
    • ECTDS
    • FLJ11172
    • FLJ13782
    • Grainyhead like 2
    • Grainyhead like 2 (Drosophila)
    • Grainyhead like protein 2 homolog
    • Grainyhead like transcription factor 2
    • Grainyhead-like protein 2 homolog
    • GRHL 2
    • GRHL2
    • GRHL2_HUMAN
    • MGC149294
    • MGC149295
    • RGD1561191
    • TFCP2L3
    • Transcription factor CP2 like 3
    • Transcription factor CP2-like 3
    see all
  • Function
    May function as a transcription factor.
  • Tissue specificity
    Highly expressed in placenta, prostate, brain and kidney. Lower-level expression in a variety of epithelial tissues such as thymus, kidney, lung, salivary gland, mammary gland and digestive tract. Expressed in the cochlear.
  • Involvement in disease
    Defects in GRHL2 are the cause of deafness autosomal dominant type 28 (DFNA28) [MIM:608641]. DFNA28 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNA28 is characterized by mild to moderate hearing loss across most frequencies that progressed to severe loss in the higher frequencies by the fifth decade. Age at onset varied, with the earliest case documented at 7 years of age.
  • Sequence similarities
    Belongs to the grh/CP2 family. Grainyhead subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up