Overview

  • Product nameRecombinant Human GRID1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9ULK0
    • SpeciesHuman
    • SequenceLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILG TTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
    • Molecular weight36 kDa including tags
    • Amino acids349 to 441

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GluD1
    • GluR delta 1
    • GluR delta 1 subunit
    • GluR delta-1 subunit
    • Glutamate receptor delta 1 subunit
    • Glutamate receptor delta-1 subunit
    • Glutamate receptor ionotropic delta 1
    • GRID 1
    • Grid1
    • GRID1_HUMAN
    • KIAA1220
    • OTTHUMP00000020002
    • OTTHUMP00000020003
    see all
  • FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.
  • Cellular localizationCell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Recombinant Human GRID1 protein images

  • 12.5% SDS-PAGE showing ab117024 at approximately 35.86 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GRID1 protein (ab117024)

ab117024 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"