Overview

  • Product name
    Recombinant Human GRID1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILG TTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
    • Molecular weight
      36 kDa including tags
    • Amino acids
      349 to 441

Specifications

Our Abpromise guarantee covers the use of ab117024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GluD1
    • GluR delta 1
    • GluR delta 1 subunit
    • GluR delta-1 subunit
    • Glutamate receptor delta 1 subunit
    • Glutamate receptor delta-1 subunit
    • Glutamate receptor ionotropic delta 1
    • GRID 1
    • Grid1
    • GRID1_HUMAN
    • KIAA1220
    • OTTHUMP00000020002
    • OTTHUMP00000020003
    see all
  • Function
    Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117024 at approximately 35.86 kDa.
    Stained with Coomassie Blue.

References

ab117024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up