Overview

  • Product name
    Recombinant Human GRID2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNV PEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
    • Amino acids
      908 to 1007
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • delta-2
    • GluD2
    • GLUR D2
    • GluR delta 2
    • GluR delta-2 subunit
    • GLURD 2
    • GLURD2
    • Glutamate receptor delta 2 subunit
    • Glutamate receptor ionotropic
    • Glutamate receptor ionotropic delta 2
    • GRID 2
    • Grid2
    • GRID2_HUMAN
    • MGC117022
    • MGC117023
    • MGC117024
    see all
  • Function
    Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID2 subfamily.
  • Domain
    The PDZ-binding motif mediates interaction with GOPC.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab158580 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up