Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP39086
    • SpeciesHuman
    • SequenceVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNK TNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMT DSNKDKSSNI
    • Molecular weight38 kDa including tags
    • Amino acids331 to 440

Specifications

Our Abpromise guarantee covers the use of ab116734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • EAA3
    • EEA3
    • Excitatory amino acid receptor 3
    • GLR5
    • GluR-5
    • GluR5
    • GluR6
    • GluR7
    • Glutamate receptor
    • Glutamate receptor 5
    • Glutamate receptor ionotropic kainate 1
    • GRIK1
    • GRIK1_HUMAN
    • Human glutamate receptor GLUR5
    • ionotropic kainate 1
    • OTTHUMP00000096569
    see all
  • FunctionIonotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus.
  • Tissue specificityMost abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily.
  • Cellular localizationCell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Recombinant Human GRIK1 protein images

  • 12.5% SDS-PAGE of ab116734 stained with Coomassie Blue.

References for Recombinant Human GRIK1 protein (ab116734)

ab116734 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"