Overview

  • Product name
    Recombinant Human GRK4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLD AVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKE ENPSKKAFEE
    • Amino acids
      36 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor kinase 4
    • G protein-coupled receptor kinase 2 (Drosophila)-like
    • G protein-coupled receptor kinase 4
    • G protein-coupled receptor kinase GRK4
    • G proteinm coupled receptor kinase GRK4
    • GPRK2L
    • GPRK4
    • GRK4
    • GRK4_HUMAN
    • GRK4a
    • ITI1
    see all
  • Function
    Specifically phosphorylates the activated forms of G protein-coupled receptors. GRK4-alpha can phosphorylate rhodopsin and its activity is inhibited by calmodulin; the other three isoforms do not phosphorylate rhodopsin and do not interact with calmodulin. GRK4-alpha and GRK4-gamma phosphorylate DRD3. Phosphorylates ADRB2.
  • Tissue specificity
    Isoform 1, isoform 2, isoform 3, and isoform 4 are expressed in testis. Isoform 4 is expressed in myometrium.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Palmitoylated.
  • Cellular localization
    Cytoplasm. Cytoplasm > cell cortex. Both at the cell surface and dispersed in the cytoplasm under basal conditions. Receptor stimulation results in the internalization of GRK4 to the perinuclear area, where co-localization with DRD3 is observed strongly at 5 and 15 minutes. DRD3 and GRK4 co-localize in lipid rafts of renal proximal tubule cells.
  • Information by UniProt

Images

  • ab158570 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up