Recombinant Human Growth Hormone protein (ab83992)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKE QKYSFLQNPQTSLCFSESIPTPSN REETQQKSNLELLRISLLLIQSWL EPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMG RLEDGSPRT GQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSV EGS CGF

Specifications

Our Abpromise guarantee covers the use of ab83992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • gH
    • GH-N
    • GH1
    • GHN
    • Growth hormone
    • Growth hormone 1
    • Growth hormone, normal
    • Growth hormone, pituitary
    • HG1
    • hGH-N
    • IGHD1B
    • Pituitary growth hormone
    • RNGHGP
    • SOMA_HUMAN
    • Somatotropin
    see all
  • FunctionPlays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
  • Involvement in diseaseDefects in GH1 are a cause of growth hormone deficiency isolated type 1A (IGHD1A) [MIM:262400]; also known as pituitary dwarfism I. IGHD1A is an autosomal recessive deficiency of GH which causes short stature. IGHD1A patients have an absence of GH with severe dwarfism and often develop anti-GH antibodies when given exogenous GH.
    Defects in GH1 are a cause of growth hormone deficiency isolated type 1B (IGHD1B) [MIM:612781]; also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH. Dwarfism is less severe than in IGHD1A and patients usually respond well to exogenous GH.
    Defects in GH1 are the cause of Kowarski syndrome (KWKS) [MIM:262650]; also known as pituitary dwarfism VI.
    Defects in GH1 are a cause of growth hormone deficiency isolated type 2 (IGHD2) [MIM:173100]. IGHD2 is an autosomal dominant deficiency of GH which causes short stature. Clinical severity is variable. Patients have a positive response and immunologic tolerance to growth hormone therapy.
  • Sequence similaritiesBelongs to the somatotropin/prolactin family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human Growth Hormone protein (ab83992)

ab83992 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"