Recombinant human Growth hormone receptor protein (Fc Chimera Active) (ab180056)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGT KNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYC IKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWE APRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEY EVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
    • Molecular weight
      54 kDa including tags
    • Amino acids
      27 to 264
    • Additional sequence information
      Growth hormone receptor Fc Chimera, fused with Fc fragment of Human IgG1 at the C terminus.

Specifications

Our Abpromise guarantee covers the use of ab180056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells in the presence of 0.2 ng/mL of rhGH. The ED50 for this effect is typically 0.8 - 3.5 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.00
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names
    • GH receptor
    • GH-binding protein
    • GHBP
    • GHBP, included
    • GHR
    • GHR_HUMAN
    • Growth hormone binding protein
    • Growth hormone receptor
    • Growth hormone receptor precursor
    • Growth hormone-binding protein
    • Growth hormone-binding protein, included
    • Increased responsiveness to growth hormone, included
    • Serum binding protein
    • Serum-binding protein
    • Somatotropin receptor
    see all
  • Function
    Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway.
    The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
    Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling.
  • Tissue specificity
    Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is highly expressed in placental villi. Isoform 2 is expressed in lung, stomach and muscle. Low levels in liver.
  • Involvement in disease
    Defects in GHR are a cause of Laron syndrome (LARS) [MIM:262500]. A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone.
    Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    The extracellular domain is the ligand-binding domain representing the growth hormone-binding protein (GHBP).
    The ubiquitination-dependent endocytosis motif (UbE) is required for recruitment of the ubiquitin conjugation system on to the receptor and for its internalization.
  • Post-translational
    modifications
    The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17.
    On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2.
    On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization.
  • Cellular localization
    Secreted; Cell membrane. On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway and Cell membrane. Remains fixed to the cell membrane and is not internalized.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab180056 in reducing (lane 1) and non-reducing (lane 2) conditions. Gel stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 66-85 kDa and non-reduced protein migrates as 135-160 kDa.

References

ab180056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up