Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAGSVADSDAVVKLDDGHLNNSLSSP VQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDS EDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRV EILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 172
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab111625 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Galectin-related protein
    • GRP
    • HSPC159
    • lectin, galactoside-binding-like
    • LEGL_HUMAN
    • LGALSL
    • MGC188016
    • MGC33751
    • MGC71953
    • RGD1307414
    see all
  • Function
    Does not bind lactose, and may not bind carbohydrates.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111625 at approximately 21.6kDa (3µg).

References

ab111625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up