Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAGSVADSDAVVKLDDGHLNNSLSSP VQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDS EDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRV EILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 172
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab111625 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Galectin-related protein
    • GRP
    • HSPC159
    • lectin, galactoside-binding-like
    • LEGL_HUMAN
    • LGALSL
    • MGC188016
    • MGC33751
    • MGC71953
    • RGD1307414
    see all
  • Function
    Does not bind lactose, and may not bind carbohydrates.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

Recombinant Human GRP protein images

  • 15% SDS-PAGE showing ab111625 at approximately 21.6kDa (3µg).

References for Recombinant Human GRP protein (ab111625)

ab111625 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up