Recombinant Human GRPEL2 protein (ab165378)

Overview

  • Product name
    Recombinant Human GRPEL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPP DELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVED AKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLL EAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQ DGYKLHGRTIRLARVEVAVESQRRL
    • Amino acids
      1 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GrpE like 2, mitochondrial
    • GrpE protein homolog 2
    • GRPE2_HUMAN
    • GRPEL 2
    • Grpel2
    • mitochondrial
    • Mt GrpE#2
    • Mt-GrpE#2
    see all
  • Function
    Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
  • Sequence similarities
    Belongs to the grpE family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab165378 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up