Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVI ILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASR YLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQA SHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNI HVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV
    • Molecular weight
      68 kDa including tags
    • Amino acids
      1 to 384
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114381 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BB2
    • Bombesin BB2 receptor
    • bombesin receptor 2
    • Gastrin Releasing Peptide Receptor
    • Gastrin-releasing peptide receptor
    • GRP preferring bombesin receptor
    • GRP R
    • GRP-preferring bombesin receptor
    • GRP-R
    • Grp/bombesin receptor
    • Grpr
    • GRPR_HUMAN
    see all
  • Function
    Receptor for gastrin releasing peptide (GRP). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity
    Highly expressed in pancreas. Also expressed in stomach, adrenal cortex and brain.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human GRPR protein images

  • ab114381 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human GRPR protein (ab114381)

ab114381 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up