Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.5.1.18
    • Glutathione S transferase 2
    • Glutathione S transferase A2
    • Glutathione S-alkyltransferase A2
    • Glutathione S-aralkyltransferase A2
    • Glutathione S-aryltransferase A2
    • Glutathione S-transferase alpha 2
    • Glutathione S-transferase GT41A
    • Glutathione S-transferase Ya-2
    • Glutathione S-transferase, alpha 2 (Yc2)
    • GST 1b-1b
    • GST A2-2
    • GST class alpha member 2
    • GST gamma
    • GST HA subunit 2
    • GST Ya2
    • GST, class alpha, 2
    • GST2
    • Gst2-2
    • GSTA2 2
    • GSTA2-2
    • Gstc-2
    • Gstc2
    • GTA2
    • GTH2
    • HA subunit 2
    • Liver GST2
    • MGC10525
    • OTTHUMP00000017883
    • S-(hydroxyalkyl)glutathione lyase A2
    see all
  • Relevance
    Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.
  • Cellular localization
    Cytoplasmic

Images

  • ab158597 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up