Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKL RNDG YLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKE KALIDMYI EGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRY FPAFEKVLKSHG QDYLVGNKLSRADIHLVELLYYVEELDSSLIS SFPLLKALKTRISNLP TVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Associated products

Specifications

Our Abpromise guarantee covers the use of ab87880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • EC 2.5.1.18
    • Glutathione S transferase 2
    • Glutathione S transferase A2
    • Glutathione S-alkyltransferase A2
    • Glutathione S-aralkyltransferase A2
    • Glutathione S-aryltransferase A2
    • Glutathione S-transferase alpha 2
    • Glutathione S-transferase GT41A
    • Glutathione S-transferase Ya-2
    • Glutathione S-transferase, alpha 2 (Yc2)
    • GST 1b-1b
    • GST A2-2
    • GST class alpha member 2
    • GST gamma
    • GST HA subunit 2
    • GST Ya2
    • GST, class alpha, 2
    • GST2
    • Gst2-2
    • GSTA2 2
    • GSTA2-2
    • Gstc-2
    • Gstc2
    • GTA2
    • GTH2
    • HA subunit 2
    • Liver GST2
    • MGC10525
    • OTTHUMP00000017883
    • S-(hydroxyalkyl)glutathione lyase A2
    see all
  • RelevanceCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.
  • Cellular localizationCytoplasmic

References for Recombinant Human GSTA2 protein (ab87880)

ab87880 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"