Overview

  • Product nameRecombinant Human GSTA3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16772
    • SpeciesHuman
    • SequenceMAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSL MFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA DLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVG NKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF
    • Molecular weight51 kDa including tags
    • Amino acids1 to 222

Specifications

Our Abpromise guarantee covers the use of ab116930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutathione S alkyltransferase A3
    • Glutathione S aralkyltransferase A3
    • Glutathione S aryltransferase A3
    • Glutathione S transferase A3
    • Glutathione S transferase A3 3
    • glutathione S transferase A3 subunit
    • Glutathione S transferase alpha 3
    • Glutathione S transferase alpha type (Ya)
    • glutathione S transferase Yc 1
    • glutathione S transferase Yc1 subunit
    • Glutathione S-transferase A3
    • Glutathione S-transferase A3-3
    • Glutathione S-transferase Ya3
    • Glutathione S-transferase Yc
    • glutathione transferase A3 subunit
    • Glutathione transferase alpha 3
    • GST 2 2
    • GST AA
    • GST class alpha
    • GST class alpha member 3
    • GST class-alpha member 3
    • GST Yc1
    • GSTA 3
    • Gsta3
    • GSTA3 3
    • GSTA3-3
    • GSTA3_HUMAN
    • Gstyc
    • GTA 3
    • GTA3
    • MGC22232
    • S (hydroxyalkyl)glutathione lyase A3
    • Yc1
    see all
  • FunctionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively.
  • Sequence similaritiesBelongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human GSTA3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116930 at approximately 50.53 kDa.

References for Recombinant Human GSTA3 protein (ab116930)

ab116930 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"