Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15217
    • SpeciesHuman
    • SequenceMAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHL LFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTL DLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVG NQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP GSKKKPPPDEIYVRTVYNIFRP
    • Molecular weight50 kDa including tags
    • Amino acids1 to 222

Specifications

Our Abpromise guarantee covers the use of ab117039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686D21185
    • Glutathione S alkyltransferase A4
    • Glutathione S aralkyltransferase A4
    • Glutathione S aryltransferase A4
    • Glutathione S transferase A4
    • Glutathione S transferase A4 4
    • Glutathione S transferase alpha 4
    • Glutathione S-transferase A4
    • Glutathione S-transferase A4-4
    • Glutathione transferase A4 4
    • GST class alpha member 4
    • GST class-alpha member 4
    • GSTA4
    • GSTA4 4
    • GSTA4_HUMAN
    • GTA4
    • OTTHUMP00000016624
    • OTTHUMP00000016625
    • S (hydroxyalkyl)glutathione lyase A4
    see all
  • FunctionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
  • Tissue specificityExpressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
  • Sequence similaritiesBelongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human GSTA4 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117039 at approximately 50.16 kDa.

References for Recombinant Human GSTA4 protein (ab117039)

ab117039 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"