Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVY NIFRP
    • Molecular weight
      32 kDa including tags
    • Amino acids
      168 to 222

Specifications

Our Abpromise guarantee covers the use of ab117040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686D21185
    • Glutathione S alkyltransferase A4
    • Glutathione S aralkyltransferase A4
    • Glutathione S aryltransferase A4
    • Glutathione S transferase A4
    • Glutathione S transferase A4 4
    • Glutathione S transferase alpha 4
    • Glutathione S-transferase A4
    • Glutathione S-transferase A4-4
    • Glutathione transferase A4 4
    • GST class alpha member 4
    • GST class-alpha member 4
    • GSTA4
    • GSTA4 4
    • GSTA4_HUMAN
    • GTA4
    • OTTHUMP00000016624
    • OTTHUMP00000016625
    • S (hydroxyalkyl)glutathione lyase A4
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
  • Tissue specificity
    Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
  • Sequence similarities
    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117040 at approximately 31.68 kDa.

References

ab117040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up