Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP28161
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPMTLGYWNIRGLAHSIRLLLEYTDSSYEE KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYI ARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQA LPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
    • Molecular weight28 kDa
    • Amino acids1 to 218
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99435 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glutathione S alkyltransferase M2
    • Glutathione S aralkyltransferase M2
    • Glutathione S aryltransferase M2
    • Glutathione S transferase 4
    • Glutathione S transferase M1
    • Glutathione S transferase M2 (muscle)
    • Glutathione S transferase Mu 2
    • Glutathione S transferase Mu 2 (muscle)
    • Glutathione S-transferase Mu 2
    • GST class mu 2
    • GST class-mu 2
    • GST muscle
    • GST4
    • GSTM
    • GSTM2
    • GSTM2-2
    • GSTM2_HUMAN
    • GTHMUS
    • MGC117303
    • S (hydroxyalkyl)glutathione lyase M2
    see all
  • FunctionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificityMuscle.
  • Sequence similaritiesBelongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human GSTM2 protein images

  • 15% SDS-PAGE showing ab99435 at approximately 27.9kDa (3µg).

References for Recombinant Human GSTM2 protein (ab99435)

ab99435 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"