Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSMTLGYWDIRGLAHAIRLLLEYTDSSYEE KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI ARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEE LPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 218
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab97949 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glutathione S transferase M4
    • Glutathione S transferase Mu 4
    • Glutathione S-transferase Mu 4
    • GST class mu 4
    • GST class-mu 4
    • GST-Mu2
    • GSTM4
    • GSTM4 4
    • GSTM4-4
    • GSTM4_HUMAN
    • GTM4
    • GTS Mu2
    • MGC131945
    • MGC9247
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Active on 1-chloro-2,4-dinitrobenzene.
  • Tissue specificity
    Expressed in a wide variety of tissues.
  • Sequence similarities
    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human GSTM4 protein images

  • 15% SDS-PAGE showing ab97949 at approximately 27.7kDa (3µg).

References for Recombinant Human GSTM4 protein (ab97949)

ab97949 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up