Recombinant Human GSTM5 protein (ab116856)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP46439
    • SpeciesHuman
    • SequenceMPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDIL ENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAG DKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS SQFLRGLLFGKSATWNSK
    • Molecular weight50 kDa including tags
    • Amino acids1 to 218

Specifications

Our Abpromise guarantee covers the use of ab116856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutathione S alkyltransferase M5
    • Glutathione S aralkyltransferase M5
    • Glutathione S aryltransferase M5
    • Glutathione S transferase M5
    • Glutathione S transferase Mu 5
    • Glutathione S-transferase Mu 5
    • GST class mu 5
    • GST class-mu 5
    • GSTM 5
    • Gstm5
    • GSTM5 5
    • GSTM5-5
    • GSTM5_HUMAN
    • GTM 5
    • GTM5
    • OTTHUMP00000013359
    • OTTHUMP00000013361
    • S (hydroxyalkyl)glutathione lyase M5
    see all
  • FunctionConjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Sequence similaritiesBelongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human GSTM5 protein images

  • 12.5% SDS-PAGE showing ab116856 at approximately 50.05kDa and stained with Coomassie Blue.

References for Recombinant Human GSTM5 protein (ab116856)

ab116856 has not yet been referenced specifically in any publications.

Product Wall

Vielen Dank für Ihren Anruf und für Ihr Interesse an unseren Produkten.

Unseres Wissens nach wurde ab116856 GSTM5 protein (Human) bisher noch nicht in Activity Assays getestet, und uns liegen daher leider auch keine Daten über die Aktivität ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"