Recombinant Human GTF2H4 protein (ab116933)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQF LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      363 to 462

Specifications

Our Abpromise guarantee covers the use of ab116933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic transcription factor 2 52 kDa subunit
    • Basic transcription factor 52 kDa subunit
    • BTF2 p52
    • General transcription factor IIH polypeptide 4
    • General transcription factor IIH polypeptide 4 52kDa
    • General transcription factor IIH polypeptide 4 52kDa subunit
    • General transcription factor IIH polypeptide 4 52kDa variant
    • General transcription factor IIH subunit 4
    • Gtf2h4
    • OTTHUMP00000029049
    • OTTHUMP00000164874
    • P52
    • TF2H4_HUMAN
    • TFB2
    • TFIIH basal transcription factor complex p52 subunit
    • TFIIH protein
    • TIFIIH
    • Transcription factor II H
    • Transcription factor IIH 52 kDa subunit
    see all
  • Function
    Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
  • Sequence similarities
    Belongs to the TFB2 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116933 at approximately 36.63 kDa.

References

ab116933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up