Recombinant Human GTF2H4 protein (ab116933)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQF LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      363 to 462

Specifications

Our Abpromise guarantee covers the use of ab116933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic transcription factor 2 52 kDa subunit
    • Basic transcription factor 52 kDa subunit
    • BTF2 p52
    • General transcription factor IIH polypeptide 4
    • General transcription factor IIH polypeptide 4 52kDa
    • General transcription factor IIH polypeptide 4 52kDa subunit
    • General transcription factor IIH polypeptide 4 52kDa variant
    • General transcription factor IIH subunit 4
    • Gtf2h4
    • OTTHUMP00000029049
    • OTTHUMP00000164874
    • P52
    • TF2H4_HUMAN
    • TFB2
    • TFIIH basal transcription factor complex p52 subunit
    • TFIIH protein
    • TIFIIH
    • Transcription factor II H
    • Transcription factor IIH 52 kDa subunit
    see all
  • Function
    Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
  • Sequence similarities
    Belongs to the TFB2 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human GTF2H4 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116933 at approximately 36.63 kDa.

References for Recombinant Human GTF2H4 protein (ab116933)

ab116933 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up