Recombinant Human GTF2IRD1 protein (ab160551)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNA EVACVAVHDESAFVVSTEKGRMFLNARKELQSDFLRFCRGPPWKDPEAEH PKKVQRGEGGGRSLPRSSLEHGSDVYLLRKMVEEVFDVLYSEALGRASVV PLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL KRPLEDGGRDSKALVELNGVSLIPKGSRDCGLHGQAPKVPPQDLPPTATS SSMASFLYSTALPNHAIRELKQEAPSCPLAPSDLGLSRPMPEPKATGAQD FSDCCGQKPTGPGGPLIQNVHASKRILFSIVHDKSEKWDAFIKETEDINT LRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKR PCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPP EDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPED LDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTDKGLSEDARPE ERPVEDSHGDVIRPLRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEE LFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIKRPELLTEGVKEP IVDSQGTASSLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRID IANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGI PFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKV ILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFR NPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKVPAKDSSIPKR KRKRVSEGNSVSSSSSSSSSSSSNPDSVASANQISFVQWPMYMVDYAGLN VQLPGPLNY
    • Amino acids
      1 to 959
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CREAM1
    • General transcription factor II I repeat domain containing protein 1
    • General transcription factor II-I repeat domain-containing protein 1
    • General transcription factor III
    • GT2D1_HUMAN
    • GTF2I repeat domain containing protein 1
    • GTF2I repeat domain-containing protein 1
    • GTF2IRD1
    • GTF3
    • Muscle TFII I repeat domain-containing protein 1
    • Muscle TFII-I repeat domain-containing protein 1
    • MUSTRD1
    • MusTRD1/BEN
    • RBAP2
    • Slow muscle fiber enhancer binding protein
    • Slow-muscle-fiber enhancer-binding protein
    • USE B1 binding protein
    • USE B1-binding protein
    • WBSCR11
    • WBSCR12
    • Williams Beuren syndrome chromosome region 11 protein
    • Williams-Beuren syndrome chromosomal region 11 protein
    • Williams-Beuren syndrome chromosomal region 12 protein
    see all
  • Function
    May be a transcription regulator involved in cell-cycle progression and skeletal muscle differentiation. May repress GTF2I transcriptional functions, by preventing its nuclear residency, or by inhibiting its transcriptional activation. May contribute to slow-twitch fiber type specificity during myogenesis and in regenerating muscles. Binds troponin I slow-muscle fiber enhancer (USE B1). Binds specifically and with high affinity to the EFG sequences derived from the early enhancer of HOXC8.
  • Tissue specificity
    Highly expressed in adult skeletal muscle, heart, fibroblast, bone and fetal tissues. Expressed at lower levels in all other tissues tested.
  • Involvement in disease
    Note=GTF2IRD1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of GTF2IRD1 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities
    Belongs to the TFII-I family.
    Contains 5 GTF2I-like repeats.
  • Developmental stage
    Highly expressed in developing and regenerating muscles, at the time of myofiber diversification.
  • Domain
    The N-terminal half may have an activating activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up