Recombinant Human GTF3C5 protein (ab160430)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDG AENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGK EQLTYESG
    • Amino acids
      378 to 485
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20857
    • General transcription factor 3C polypeptide 5
    • General transcription factor IIIC polypeptide 5 63kDa
    • GTF3C5
    • TF3C epsilon
    • TF3C-epsilon
    • TF3C5_HUMAN
    • TFIIIC 63 kDa subunit
    • TFiiiC2 63
    • TFIIIC63
    • TFIIICepsilon
    • Transcription factor IIIC 63 kDa subunit
    • Transcription factor IIIC epsilon subunit
    • Transcription factor IIIC subunit epsilon
    see all
  • Function
    Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters.
  • Sequence similarities
    Belongs to the TFIIIC subunit 5 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160430 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up