Recombinant Human GTPBP1 protein (ab160549)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLR ERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGEL DNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSL EWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGI VGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCR KIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSP RTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLG NFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLN PQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTG DKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSK PQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSN LQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC
    • Amino acids
      1 to 584
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein 1
    • G-protein 1
    • GP 1
    • GP-1
    • GP1
    • GTP binding protein 1
    • GTP-binding protein 1
    • GTPB1_HUMAN
    • GTPBP1
    see all
  • Function
    Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity.
  • Sequence similarities
    Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. GTPBP1 subfamily.
    Contains 1 tr-type G (guanine nucleotide-binding) domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160549 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up