Recombinant Human Guanylate kinase protein (ab99210)

Overview

  • Product nameRecombinant Human Guanylate kinase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16774
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSGPRPVVLSGPSGAGKSTLLKRLLQEHSG IFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNL YGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVL EQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAE LKEALSEEIKKAQRTGA
    • Molecular weight24 kDa including tags
    • Amino acids1 to 197
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99210 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ATP:GMP phosphotransferase
    • FLJ42686
    • FLJ43710
    • GMK
    • GMP kinase
    • Guanylate kinase
    • GUK1
    • KGUA_HUMAN
    see all
  • FunctionEssential for recycling GMP and indirectly, cGMP.
  • Sequence similaritiesBelongs to the guanylate kinase family.
    Contains 1 guanylate kinase-like domain.
  • Information by UniProt

Recombinant Human Guanylate kinase protein images

  • 15% SDS-PAGE analysis of 3µg ab99210.

References for Recombinant Human Guanylate kinase protein (ab99210)

ab99210 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"