Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14520
    • SpeciesHuman
    • SequenceGNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVC RPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
    • Molecular weight37 kDa including tags
    • Amino acids105 to 204

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Factor seven activating protease
    • Factor seven-activating protease
    • Factor VII activating protein
    • Factor VII-activating protease
    • FSAP
    • HABP
    • HABP 2
    • Habp2
    • HABP2_HUMAN
    • Hepatocyte growth factor activator like protein
    • Hepatocyte growth factor activator-like protein
    • HGFAL
    • Hyaluronan binding protein 2
    • Hyaluronan-binding protein 2 27 kDa light chain alternate form
    • Hyaluronic acid binding protein 2
    • PHBP
    • Plasma hyaluronan binding protein
    • Plasma hyaluronan-binding protein
    see all
  • FunctionCleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly. It does not cleave (activate) prothrombin and plasminogen but converts the inactive single chain urinary plasminogen activator (pro-urokinase) to the active two chain form. Activates coagulation factor VII.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 3 EGF-like domains.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Proteolytic cleavage at Gly-23 or Met-27 can give rise to the 50 kDa heavy chain and cleavage at Arg-313 or Lys-319 can give rise to the 27 kDa light chain. The heavy chain can undergo further proteolytic cleavage at Lys-169 or Arg-170 to give rise to 2 inactive 26 kDa fragments and the light chain can undergo further proteolytic cleavage at Arg-480 to give rise to inactive 17 kDa and 8 kDa fragments.
  • Cellular localizationSecreted. Secreted as an inactive single-chain precursor and is then activated to a heterodimeric form.
  • Information by UniProt

Recombinant Human HABP2 protein images

  • ab114685 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human HABP2 protein (ab114685)

ab114685 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"