Overview

  • Product name
    Recombinant Human HACE1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANI MGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVAL HCGSYGYTMA
    • Amino acids
      800 to 909
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase HACE1
    • HACE 1
    • HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1
    • KIAA1320
  • Relevance
    E3 ubiquitin-protein ligase that may function in cellular proteins degradation. HACE1 has also been shown to be down-regulated in many human tumours and is a putative candidate tumor suppressor.
  • Cellular localization
    Cytoplasmic, Endoplasmic reticulum and Golgi Apparatus. A significant portion localizes to the endoplasmic reticulum.

Images

  • ab163578 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up