Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRN VVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIF GTVIQE
    • Amino acids
      4 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 enoyl Coenzyme A (CoA) hydratase beta subunit
    • 3 ketoacyl Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein beta subunit
    • 3 ketoacyl Coenzyme A thiolase
    • 3 ketoacyl Coenzyme A thiolase of mitochondrial trifunctional protein beta subunit
    • 3-ketoacyl-CoA thiolase
    • Acetyl CoA acyltransferase
    • Acetyl-CoA acyltransferase
    • Beta ketothiolase
    • Beta-ketothiolase
    • ECHB
    • ECHB_HUMAN
    • HADH
    • Hadhb
    • Hydroxyacyl CoA dehydrogenase/3 ketoacyl CoA thiolase/enoyl CoA hydratase (trifunctional protein), beta subunit
    • Hydroxyacyl Coenzyme A (CoA) dehydrogenase beta subunit
    • Hydroxyacyl Coenzyme A dehydrogenase
    • Hydroxyacyl Coenzyme A dehydrogenase beta subunit
    • Hydroxyacyl Coenzyme A dehydrogenase/3 ketoacyl Coenzyme A thiolase/enoyl Coenzyme A hydratase (trifunctional protein) beta subunit
    • MGC87480
    • Mitochondrial trifunctional enzyme beta subunit
    • Mitochondrial trifunctional protein beta subunit
    • MSTP 029
    • MSTP029
    • MTPB
    • TP beta
    • TP-beta
    • TPbeta
    • Trifunctional enzyme subunit beta
    • Trifunctional enzyme subunit beta mitochondrial
    • Trifunctional protein
    see all
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease
    Defects in HADHB are a cause of trifunctional protein deficiency (TFP deficiency) [MIM:609015]. The clinical manifestations are very variable and include hypoglycemia, cardiomyopathy and sudden death. Phenotypes with mainly hepatic and neuromyopathic involvement can also be distinguished. Biochemically, TFP deficiency is defined by the loss of all three enzyme activities of the TFP complex.
  • Sequence similarities
    Belongs to the thiolase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab158633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up