Overview

  • Product nameRecombinant Human HAO1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UJM8
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMLPRLICINDYEQH AKSVLPKSIYDYYRSGAN DEETLADNIAAFSRWKLYPRMLRNVAETDL STSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMML SSW ATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVD TPYLGNRLDDVRNRFKLPPQLR MKNFETSTLSFSPEENFGDDSGLAAY VAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILV SNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALAL GAKAVFVGRPIVWGLAFQGEKGVQDV LEILKEEFRLAMALSGCQNVKV IDKTLVRKNPLAVSKI
    • Molecular weight45 kDa including tags
    • Amino acids1 to 370
    • TagsHis tag N-Terminus , DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113144 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 2.92% Sodium chloride

General Info

  • Alternative names
    • (S) 2 hydroxy acid oxidase
    • Glycolate oxidase
    • GOX
    • GOX1
    • HAO1
    • HAOX1
    • HAOX1_HUMAN
    • Hydroxyacid oxidase 1
    • MGC142225
    • MGC142227
    • OTTHUMP00000030231
    see all
  • FunctionHas 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificityLiver.
  • PathwayOrganic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similaritiesBelongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localizationPeroxisome.
  • Information by UniProt

Recombinant Human HAO1 protein images

  • 15% SDS-PAGE analysis of ab113144 (3µg)

References for Recombinant Human HAO1 protein (ab113144)

ab113144 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"