Overview

  • Product name
    Recombinant Human HAO2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPR YLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAG ICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQLIQRVESLGF KALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPIS TSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQ LDEVLASIDALTEVVAAVKGKIEVYLDGGVRTGNDVLKALALGAKCIFLG RPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L
    • Amino acids
      1 to 351
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (S)-2-hydroxy-acid oxidase
    • (S)-2-hydroxy-acid oxidase, peroxisomal
    • 2 hydroxy acid oxidase peroxisomal
    • Cell growth-inhibiting gene 16 protein
    • GIG16
    • Glycolate oxidase
    • HAO 2
    • Hao2
    • HAOX2
    • HAOX2_HUMAN
    • Hydroxyacid oxidase 2
    • Hydroxyacid oxidase 2 (long chain)
    • Long chain alpha hydroxy acid oxidase
    • Long chain alpha-hydroxy acid oxidase
    • Long chain L 2 hydroxy acid oxidase
    • Long-chain L-2-hydroxy acid oxidase
    • peroxisomal
    see all
  • Function
    Catalyzes the oxidation of L-alpha-hydroxy acids as well as, more slowly, that of L-alpha-amino acids.
  • Tissue specificity
    Liver and kidney.
  • Sequence similarities
    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • ab162447 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up