Recombinant Human HAPLN1 protein (ab158200)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVF SHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGY HKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTV VVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRG GLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDV FCFTSNFNGRFYYLIHPTKLTYDVAVQACLNDGAQIAKVGQIFAAWKILG YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCF RAYN
    • Amino acids
      1 to 354
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cartilage link protein
    • cartilage linking protein 1
    • Cartilage-link protein
    • Cartilage-linking protein 1
    • CLP
    • CRTL1
    • Crtl1l
    • HAPLN1
    • HPLN1_HUMAN
    • Hyaluronan and proteoglycan link protein 1
    • Hyaluronan and proteoglycan link protein 1 precursor
    • LP
    • Proteoglycan link protein
    see all
  • Function
    Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
  • Tissue specificity
    Widely expressed. Weakly expressed in the brain.
  • Sequence similarities
    Belongs to the HAPLN family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • ab158200 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up