Recombinant Human HAPLN1 protein (denatured) (ab180280)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSDHLSDNYTLDHDRAIHIQAENGPHLLV EAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEV DVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVI EGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFD QLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWD KDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQI FAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKH KLYGVYCFRAYN
    • Molecular weight
      41 kDa including tags
    • Amino acids
      16 to 354
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature protein; NP_001875.

Specifications

Our Abpromise guarantee covers the use of ab180280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • Cartilage link protein
    • cartilage linking protein 1
    • Cartilage-link protein
    • Cartilage-linking protein 1
    • CLP
    • CRTL1
    • Crtl1l
    • HAPLN1
    • HPLN1_HUMAN
    • Hyaluronan and proteoglycan link protein 1
    • Hyaluronan and proteoglycan link protein 1 precursor
    • LP
    • Proteoglycan link protein
    see all
  • Function
    Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
  • Tissue specificity
    Widely expressed. Weakly expressed in the brain.
  • Sequence similarities
    Belongs to the HAPLN family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180280 (3μg).

References

ab180280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up