Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDES KQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELK ETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRY HIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILS SLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVK NEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLG DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEE PLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEAL EEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLN QLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKR RTGQPLCIC
    • Molecular weight
      57 kDa
    • Amino acids
      1 to 509
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Purity
    > 85 % n/a.
    ab185599 was purified by multi-step chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.2
    Constituents: 20% Glycerol, 1.17% Sodium chloride, 78% PBS

General Info

  • Alternative names
    • cytoplasmic
    • EC 6.1.1.21
    • FLJ20491
    • HARS
    • HisRS
    • Histidine tRNA ligase, cytoplasmic
    • histidine translase
    • Histidine tRNA ligase
    • Histidine--tRNA ligase
    • Histidyl tRNA synthetase
    • Histidyl-tRNA synthetase
    • HRS
    • Human histidyl tRNA synthetase homolog (HO3) mRNA complete cds
    • SYHC_HUMAN
    • USH3B
    see all
  • Tissue specificity
    Brain, heart, liver and kidney.
  • Involvement in disease
    Defects in HARS are a cause of Usher syndrome type 3B (USH3B) [MIM:614504]. USH3B is a syndrome characterized by progressive vision and hearing loss during early childhood. Some patients have the so-called 'Charles Bonnet syndrome,' involving decreased visual acuity and vivid visual hallucinations. USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH3 is characterized by postlingual, progressive hearing loss, variable vestibular dysfunction, and onset of retinitis pigmentosa symptoms, including nyctalopia, constriction of the visual fields, and loss of central visual acuity, usually by the second decade of life.
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
    Contains 1 WHEP-TRS domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 3.5 µg ab185599.

References

ab185599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up