Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP12081
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAERAALEELVKLQGERVRGLKQQKAS AELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVF DVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSL RYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFD IAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVS DSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGV SLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARG LDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKV PCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKL VSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIK LRSVTSREEVDVRREDLVEEIKRRTGQPLCIC
    • Molecular weight59 kDa including tags
    • Amino acids1 to 509
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99387 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • cytoplasmic
    • EC 6.1.1.21
    • FLJ20491
    • HARS
    • HisRS
    • Histidine tRNA ligase, cytoplasmic
    • histidine translase
    • Histidine tRNA ligase
    • Histidine--tRNA ligase
    • Histidyl tRNA synthetase
    • Histidyl-tRNA synthetase
    • HRS
    • Human histidyl tRNA synthetase homolog (HO3) mRNA complete cds
    • SYHC_HUMAN
    • USH3B
    see all
  • Tissue specificityBrain, heart, liver and kidney.
  • Involvement in diseaseDefects in HARS are a cause of Usher syndrome type 3B (USH3B) [MIM:614504]. USH3B is a syndrome characterized by progressive vision and hearing loss during early childhood. Some patients have the so-called 'Charles Bonnet syndrome,' involving decreased visual acuity and vivid visual hallucinations. USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH3 is characterized by postlingual, progressive hearing loss, variable vestibular dysfunction, and onset of retinitis pigmentosa symptoms, including nyctalopia, constriction of the visual fields, and loss of central visual acuity, usually by the second decade of life.
  • Sequence similaritiesBelongs to the class-II aminoacyl-tRNA synthetase family.
    Contains 1 WHEP-TRS domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human HARS protein images

  • 15% SDS-PAGE analysis of 3µg ab99387.

References for Recombinant Human HARS protein (ab99387)

ab99387 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"