Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRC GTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
    • Amino acids
      169 to 268
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCHL
    • CCHL_HUMAN
    • cytochrome c heme-lyase
    • Cytochrome c-type heme lyase
    • DKFZp779I1858
    • EC 4.4.1.17
    • Hccs
    • Holocytochrome c synthase
    • Holocytochrome c synthase (cytochrome c heme lyase)
    • Holocytochrome c type synthase
    • Holocytochrome c-type synthase
    • MCOPS7
    • OTTHUMP00000022903
    • OTTHUMP00000022904
    • OTTHUMP00000022905
    • OTTMUSP00000021173
    • OTTMUSP00000021174
    • RGD1563855
    • RP23-37L2.1
    see all
  • Function
    Links covalently the heme group to the apoprotein of cytochrome c.
  • Involvement in disease
    Microphthalmia, syndromic, 7
  • Sequence similarities
    Belongs to the cytochrome c-type heme lyase family.
    Contains 2 HRM (heme regulatory motif) repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158646 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up