Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSML SNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTT ENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIE AAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE DEDEDGKKESETGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKL GEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGL IDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP GRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQ IKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSIS NPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT
    • Amino acids
      1 to 597
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAP1A
    • GTase
    • GTP--RNA guanylyltransferase
    • hCAP
    • HCAP1
    • HcE
    • HCE1
    • MCE1
    • MCE1_HUMAN
    • mRNA 5''-triphosphatase
    • mRNA capping enzyme
    • mRNA guanyltransferase
    • mRNA guanylyltransferase
    • Polynucleotide 5' trisphosphatase
    • RNA guanylyltransferase and 5' phosphatase
    • RNGTT
    • TPase
    see all
  • Function
    Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. Catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
  • Tissue specificity
    Isoform 1 and isoform 4 (at a lesser extent) are expressed in cerebrum, cerebellum, thyroid, lung, heart, liver, kidney, spleen, large intestine, testis, skin and muscle.
  • Sequence similarities
    In the N-terminal section; belongs to the non-receptor class of the protein-tyrosine phosphatase family.
    In the C-terminal section; belongs to the eukaryotic GTase family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160166 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up