Recombinant Human hCG beta protein (ab191924)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQVDHHH HHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      21 to 165
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 21 to 165. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • CG beta
    • CG-beta
    • CGB
    • CGB3
    • CGB5
    • CGB7
    • CGB8
    • CGHB_HUMAN
    • Choriogonadotropin subunit beta
    • Chorionic gonadotrophin chain beta
    • Chorionic gonadotropin beta 3 subunit
    • Chorionic gonadotropin beta polypeptide
    • Chorionic gonadotropin beta subunit
    • hCGB
    see all
  • Function
    Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
  • Tissue specificity
    Placenta.
  • Sequence similarities
    Belongs to the glycoprotein hormones subunit beta family.
  • Developmental stage
    Made by the first trimester placenta.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab191924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up