Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESE PVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
    • Molecular weight
      36 kDa including tags
    • Amino acids
      266 to 355

Specifications

Our Abpromise guarantee covers the use of ab116927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cortactin like
    • CTTNL
    • HCLS 1
    • Hcls1
    • HCLS1_HUMAN
    • Hematopoietic cell specific Lyn substrate 1
    • Hematopoietic cell-specific LYN substrate 1
    • Hematopoietic lineage cell-specific protein
    • HS 1
    • HS1
    • LckBP1
    • OTTHUMP00000215180
    • OTTHUMP00000215182
    • p75
    see all
  • Function
    Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.
  • Tissue specificity
    Expressed only in tissues and cells of hematopoietic origin.
  • Sequence similarities
    Contains 4 cortactin repeats.
    Contains 1 SH3 domain.
  • Developmental stage
    Expressed in early stage of myeloid and erythroid differentiation.
  • Post-translational
    modifications
    Phosphorylated by LYN; rapidly after cross-linking of surface IgM on B-cells.
  • Cellular localization
    Membrane. Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116927 at approximately 35.53 kDa.

References

ab116927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up