Overview

  • Product name
    Recombinant Human HCM protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANSAKAEEYEKMSLEQAKASVNSETESSF NINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKESSSCGKDTPSK KRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIA LEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIAD VSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEA SETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNE MAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLV SEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 476
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab108376 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • DKFZp686H1252
    • EC 2.1.1.56
    • hcm1p
    • hCMT1
    • HCMT1a
    • hCMT1c
    • hMet
    • hypothetical protein KIAA0396
    • KIAA0398
    • MCES_HUMAN
    • MET
    • mRNA (guanine 7)methyltransferase
    • mRNA (guanine N(7)) methyltransferase
    • mRNA (guanine-N(7)-)-methyltransferase
    • mRNA cap guanine-N7 methyltransferase
    • mRNA cap methyltransferase
    • OTTHUMP00000162509
    • RG7MT1
    • RNA (guanine 7) methyltransferase
    • RNA guanine 7 methyltransferase
    • Rnmt
    see all
  • Function
    mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. mRNA cap methyltransferase family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab108376 (3µg)

References

ab108376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up