Overview

  • Product name
    Recombinant Human HCM protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMANSAKAEEYEKMSLEQAKASVNSETESSF NINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKESSSCGKDTPSK KRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIA LEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIAD VSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEA SETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNE MAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLV SEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 476
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab108376 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • DKFZp686H1252
    • EC 2.1.1.56
    • hcm1p
    • hCMT1
    • HCMT1a
    • hCMT1c
    • hMet
    • hypothetical protein KIAA0396
    • KIAA0398
    • MCES_HUMAN
    • MET
    • mRNA (guanine 7)methyltransferase
    • mRNA (guanine N(7)) methyltransferase
    • mRNA (guanine-N(7)-)-methyltransferase
    • mRNA cap guanine-N7 methyltransferase
    • mRNA cap methyltransferase
    • OTTHUMP00000162509
    • RG7MT1
    • RNA (guanine 7) methyltransferase
    • RNA guanine 7 methyltransferase
    • Rnmt
    see all
  • Function
    mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. mRNA cap methyltransferase family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human HCM protein images

  • 15% SDS-PAGE analysis of ab108376 (3µg)

References for Recombinant Human HCM protein (ab108376)

ab108376 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up