Recombinant human HDAC10 protein (ab157080)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRL SAREASEEELGLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTF HCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAAANGFCVFNNV AIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHG RFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLA FEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLD QPCLCPAPSVRTAVALTTPDITLVLPPDVIQQEASALREETEAWARPHES LAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLS HGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPV MTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYL RGQLEPQWKMLQCHPHLVA
    • Molecular weight
      71 kDa including tags
    • Amino acids
      1 to 669
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Hydrolysis of N-e-acetyl-lysine residues of histones.
    Specific Activity: >2U/µg. One unit is defined as the amount of enzyme that deacetylates 1 pmol/min of Fluor de Lys™-SIRT1 substrate at 37°C / 500µM.
  • Applications

    Functional Studies

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Stable on ice for approx. 1h. Snap freezing in liquid nitrogen is recommended if refreezing of remaining, undiluted enzyme if necessary. Freezing and storage of diluted enzyme is not recommended.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.61% Tris, 10% Glycerol, 0.81% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • DKFZP761B039
    • HD 10
    • HD10
    • HDA10_HUMAN
    • HDAC 10
    • Hdac10
    • Histone deacetylase 10
    • MGC149722
    • OTTHUMP00000028555
    see all
  • Function
    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
  • Tissue specificity
    Ubiquitous. High expression in liver, spleen, pancreas and kidney.
  • Sequence similarities
    Belongs to the histone deacetylase family. HD type 2 subfamily.
  • Cellular localization
    Cytoplasm. Nucleus. Excluded from the nucleoli.
  • Information by UniProt

References

ab157080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up