Recombinant human HDAC3+NCOR2 complex protein (ab179493)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Sequence
      MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKP YQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGL FEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDI VIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFF PGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPT CIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGP EENYSRPEAPNEFYDGDHDNDKESDVEI
    • Molecular weight
      83 kDa including tags
    • Amino acids
      1 to 428
    • Tags
      proprietary tag C-Terminus
    • Additional sequence information
      NM_003883.
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      KAEA AHRILEGLGP QVELPLYNQP SDTRQYHENI KINQAMRKKL ILYFKRRNHA RKQWEQKFCQ RYDQLMEAWE KKVERIENNP RRRAKESKVR EYYEKQFPEI RKQRELQERM QSRVGQRGSG LSMSAARSEH EVSEIIDGLS EQENLEKQMR QLAVIPPMLY DADQQRIKFI NMNGLMADPM KVYKDRQVMN MWSEQEKETF REKFMQHPKN FGLIASFLER KTVAECVLYY YLTKKNENYK SLVRRSYRR
    • Molecular weight
      60 kDa including tags
    • Amino acids
      237 to 489
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      NM_006312.

Specifications

Our Abpromise guarantee covers the use of ab179493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity was determined to be 55,000 RLU/min/ng.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CTG26
    • HD 3
    • HD3
    • HDAC 3
    • HDAC3
    • HDAC3_HUMAN
    • Histone deacetylase 3
    • NCOR 2
    • Nuclear receptor co repressor 2
    • RPD3
    • RPD3-2
    • SMAP45
    • SMRTE
    • SMRTE tau
    • TNRC14
    • TRAC1
    see all
  • Function
    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the histone deacetylase family. HD type 1 subfamily.
  • Post-translational
    modifications
    Sumoylated in vitro.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • The purity was determined to be > 80% by densitometry. HDAC3 MW ~83 kDa. NCOR2 MW ~60 kDa.

  • The specific activity was determined to be 55,000 RLU/min/ng.

References

ab179493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up