Overview

  • Product name
    Recombinant Human HDDC3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHLDEVELHFGAQVRRLVEEVTDDKTLPKLER KRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKIQMGSEAAQLLE AADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL HDTVEDTDTT
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 140
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113583 is purified using conventional chromatography techniques: anion exchange chromatography followed by gel filtration chromatography with 20mM Tris pH 7.5, 2mM EDTA. No detergents such as urea, Triton or Tween were used to purify the proteins. They purified the proteins by using
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • (ppGpp)ase
    • 5''-bis(diphosphate) 3''-pyrophosphohydrolase MESH1
    • Guanosine-3''
    • HD domain containing 3
    • HD domain containing protein 3
    • HD domain-containing protein 3
    • HDDC 3
    • Hddc3
    • MESH1
    • MESH1_HUMAN
    • Metazoan SpoT homolog 1
    • MGC45386
    • Penta-phosphate guanosine-3''-pyrophosphohydrolase
    see all
  • Function
    ppGpp hydrolyzing enzyme involved in starvation response.
  • Sequence similarities
    Belongs to the MESH1 family.
    Contains 1 HD domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113583 at approximately 17.9 kDa (3µg).

References

ab113583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up