Recombinant Human HDGFRP3 protein (ab116192)

Overview

  • Product name
    Recombinant Human HDGFRP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSH MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQ AIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSY TSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS EGT
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 203
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116192 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • CGI 142
    • HDGF 2
    • HDGF-2
    • HDGF2
    • HDGFRP 3
    • Hdgfrp3
    • HDGR3_HUMAN
    • Hepatoma derived growth factor 2
    • Hepatoma derived growth factor related protein 3
    • Hepatoma-derived growth factor 2
    • Hepatoma-derived growth factor-related protein 3
    • HRP 3
    • HRP-3
    • HRP3
    see all
  • Function
    Enhances DNA synthesis and may play a role in cell proliferation.
  • Tissue specificity
    Detected in testis, heart, spinal cord and brain.
  • Sequence similarities
    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab116192 at approximately 25.1kDa (3µg).

    Note: Molecular weight on SDS-PAGE will appear higher.

References

ab116192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up