Recombinant Human HDGFRP3 protein (ab116192)

Overview

  • Product name
    Recombinant Human HDGFRP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSH MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQ AIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSY TSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS EGT
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 203
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116192 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • CGI 142
    • HDGF 2
    • HDGF-2
    • HDGF2
    • HDGFRP 3
    • Hdgfrp3
    • HDGR3_HUMAN
    • Hepatoma derived growth factor 2
    • Hepatoma derived growth factor related protein 3
    • Hepatoma-derived growth factor 2
    • Hepatoma-derived growth factor-related protein 3
    • HRP 3
    • HRP-3
    • HRP3
    see all
  • Function
    Enhances DNA synthesis and may play a role in cell proliferation.
  • Tissue specificity
    Detected in testis, heart, spinal cord and brain.
  • Sequence similarities
    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human HDGFRP3 protein images

  • 15% SDS-PAGE showing ab116192 at approximately 25.1kDa (3µg).

    Note: Molecular weight on SDS-PAGE will appear higher.

References for Recombinant Human HDGFRP3 protein (ab116192)

ab116192 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up