Recombinant Human HDHD1A protein (ab101212)

Overview

  • Product nameRecombinant Human HDHD1A protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ08623
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAPPQPVTHLIFDMDGLLLDTERLYSVVF QEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQT KLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEF FSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNG VEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
    • Molecular weight27 kDa including tags
    • Amino acids1 to 228
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101212 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5''-PsiMPase
    • DXF68S1E
    • FAM16AX
    • Family with sequence similarity 16, member A, X linked
    • GS1
    • GS1 protein
    • Haloacid dehalogenase like hydrolase domain containing 1A
    • Haloacid dehalogenase like hydrolase domain containing protein 1A
    • Haloacid dehalogenase-like hydrolase domain-containing protein 1
    • Haloacid dehalogenase-like hydrolase domain-containing protein 1A
    • HDHD1
    • HDHD1_HUMAN
    • Protein GS1
    • Pseudouridine-5''-monophosphatase
    see all
  • FunctionDephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine.
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family.
  • Information by UniProt

Recombinant Human HDHD1A protein images

  • 15% SDS-PAGE analysis of 3µg ab101212.

References for Recombinant Human HDHD1A protein (ab101212)

ab101212 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"