Overview

  • Product name
    Recombinant Human HDHD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQE ALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAAR SLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQA FRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRA SDEEKINPPPYLTCESFPHAVDHILQHLL
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101940 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 0610039H12Rik
    • 3110052N05Rik
    • DKFZP564D1378
    • Haloacid dehalogenase like hydrolase domain containing 2
    • Haloacid dehalogenase-like hydrolase domain-containing protein 2
    • HDHD2
    • HDHD2_HUMAN
    • Ier3ip1
    • Immediate early response 3 interacting protein 1
    • LRRG00122
    • OTTMUSP00000045339
    • OTTMUSP00000045340
    • OTTMUSP00000045341
    • OTTMUSP00000045343
    • OTTMUSP00000045344
    • RGD1308579
    see all
  • Sequence similarities
    Belongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101940.

References

ab101940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up