Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV TPNF
    • Molecular weight
      11 kDa including tags
    • Amino acids
      31 to 124
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab184603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 95 % Densitometry.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 100% PBS

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and allow the lyophilised pellet to dissolve completely.

General Info

  • Alternative names
    • dJ461P17.6
    • EDDM4
    • epididymal protein 4
    • Epididymal secretory protein E4
    • Epididymis specific whey acidic protein type four disulfide core
    • HE 4
    • Major epididymis specific protein E4
    • Major epididymis-specific protein E4
    • MGC57529
    • Putative protease inhibitor WAP5
    • WAP 5
    • WAP domain containing protein HE4
    • WAP domain containing protein HE4 V4
    • WAP four disulfide core domain 2
    • WAP four disulfide core domain protein 2
    • WAP four-disulfide core domain protein 2
    • WAP5
    • WFDC 2
    • WFDC2
    • WFDC2_HUMAN
    see all
  • Tissue specificity
    Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.
  • Sequence similarities
    Contains 2 WAP domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab184603.

    Lane 1: Reduced and boiled HE4, 2.5 µg/lane

    Lane 2: Non-reduced and non-boiled HE4, 2.5 µg/lane

References

ab184603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up