Recombinant Human heavy chain Myosin protein (ab114308)

Overview

  • Product name
    Recombinant Human heavy chain Myosin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGK IKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      2 to 100

Specifications

Our Abpromise guarantee covers the use of ab114308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • embryonic
    • fast skeletal muscle
    • HEMHC
    • Muscle embryonic myosin heavy chain
    • Muscle embryonic myosin heavy chain 3
    • MYH 3
    • Myh3
    • MYH3_HUMAN
    • MYHC EMB
    • MYHSE 1
    • MYHSE1
    • Myosin heavy chain
    • Myosin heavy chain 3
    • Myosin heavy chain 3 skeletal muscle embryonic
    • Myosin heavy chain fast skeletal muscle embryonic
    • Myosin Heavy Polypeptide 3
    • Myosin heavy polypeptide 3 skeletal muscle embryonic
    • Myosin skeletal heavy chain embryonic 1
    • Myosin-3
    • SMHCE
    see all
  • Function
    Muscle contraction.
  • Involvement in disease
    Defects in MYH3 are the cause of distal arthrogryposis type 2A (DA2A) [MIM:193700]; also known as Freeman-Sheldon syndrome (FSS). Distal arthrogryposis is a clinically and genetically heterogeneous group of disorders characterized by bone anomalies and joint contractures of the hands and feet, causing medially overlapping fingers, clenched fists, ulnar deviation of fingers, camptodactyly and positional foot deformities. It is a disorder of primary limb malformation without primary neurologic or muscle disease. DA2A is the most severe form of distal arthrogryposis. Affected individuals have contractures of the orofacial muscles, characterized by microstomia with pouting lips, H-shaped dimpling of the chin, deep nasolabial folds, and blepharophimosis. Dysphagia, failure to thrive, growth deficit, and life-threatening respiratory complications (caused by structural anomalies of the oropharynx and upper airways) are frequent. Inheritance is autosomal dominant.
    Defects in MYH3 are the cause of distal arthrogryposis type 2B (DA2B) [MIM:601680]; also known as Sheldon-Hall syndrome (SHS) or arthrogryposis multiplex congenita distal type 2B (AMCD2B). DA2B is a form of inherited multiple congenital contractures. Affected individuals have vertical talus, ulnar deviation in the hands, severe camptodactyly, and a distinctive face characterized by a triangular shape, prominent nasolabial folds, small mouth and a prominent chin. DA2B is the most common of the distal arthrogryposis syndromes. It is similar to DA2A but the facial contractures are less dramatic.
  • Sequence similarities
    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Developmental stage
    Abundantly present in fetal skeletal muscle and not present or barely detectable in heart and adult skeletal muscle.
  • Domain
    The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
    Each myosin heavy chain can be split into 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). It can later be split further into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).
  • Cellular localization
    Cytoplasm > myofibril. Thick filaments of the myofibrils.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114308 on a 12.5% gel stained with Coomassie Blue.

References

ab114308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up