Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVRSFDGF SSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLI QKNEPTKENE
    • Amino acids
      96 to 205
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf34
    • Chromosome 6 open reading frame 34
    • Hebp2
    • HEBP2_HUMAN
    • Heme binding protein 2
    • Heme-binding protein 2
    • Placental protein 23
    • PP23
    • Protein SOUL
    • SOUL
    see all
  • Function
    Can promote mitochondrial permeability transition and facilitate necrotic cell death under different types of stress conditions. Does not bind hemin.
  • Tissue specificity
    Detected in placenta.
  • Sequence similarities
    Belongs to the HEBP family.
  • Domain
    Forms a distorted beta-barrel structure, with two helices that are packed against the outer surface of the barrel.
  • Cellular localization
    Cytoplasm. Mitochondrion. Mainly localized to the cytoplasm with a much lower abundance in the mitochondrion.
  • Information by UniProt

Images

  • ab161704 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up