Recombinant Human HECT E3 ubiquitin ligase protein (BSA and azide free) (denatured) (ab180352)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKK EFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLS LFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDN FEEVFYIHFNVHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSV KAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYE PGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITF CCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
    • Molecular weight
      43 kDa including tags
    • Amino acids
      681 to 1024
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_057407

Specifications

Our Abpromise guarantee covers the use of ab180352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • CEB1
    • CEBP1
    • Cyclin E binding protein 1
    • Cyclin-E-binding protein 1
    • E3 ISG15--protein ligase HERC5
    • HECT domain and RCC1 like domain containing protein 5
    • HECT domain and RCC1-like domain-containing protein 5
    • Hect domain and RLD 5
    • HECT E3 ubiquitin ligase
    • HERC5
    • HERC5_HUMAN
    • Herc6
    see all
  • Function
    Major E3 ligase for ISG15 conjugation. Acts as a positive regulator of innate antiviral response in cells induced by interferon. Makes part of the ISGylation machinery that recognizes target proteins in a broad and relatively non-specific manner. Catalyzes ISGylation of IRF3 which results in sustained activation, it attenuates IRF3-PIN1 interaction, which antagonizes IRF3 ubiquitination and degradation, and boosts the antiviral response. Catalyzes ISGylation of influenza A viral NS1 which attenuates virulence; ISGylated NS1 fails to form homodimers and thus to interact with its RNA targets. Catalyzes ISGylation of papillomavirus type 16 L1 protein which results in dominant-negative effect on virus infectivity. Physically associated with polyribosomes, broadly modifies newly synthesized proteins in a cotranslational manner. In an interferon-stimulated cell, newly translated viral proteins are primary targets of ISG15.
  • Tissue specificity
    Expressed in testis and to a lesser degree in brain, ovary and placenta. Found in most tissues at low levels.
  • Sequence similarities
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 5 RCC1 repeats.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm > perinuclear region. Associated with the polyribosomes, probably via the 60S subunit.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180352 (3 µg)

References

ab180352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up