Recombinant Human HECTD1 protein (ab161805)

Overview

  • Product name
    Recombinant Human HECTD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRT FLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKAL CNRLVVVE
    • Amino acids
      3 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ligase for inhibin receptor
    • E3 ubiquitin protein ligase HECTD1
    • E3 ubiquitin-protein ligase HECTD1
    • EULIR
    • HECD1_HUMAN
    • HECT domain containing protein 1
    • HECT domain-containing protein 1
    • HECTD1
    • KIAA1131
    see all
  • Function
    Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. May be required for development of the head mesenchyme and neural tube closure.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the UPL family. K-HECT subfamily.
    Contains 4 ANK repeats.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 1 MIB/HERC2 domain.
  • Information by UniProt

Images

  • ab161805 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up