Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICL EVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPV ITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENN PEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
    • Amino acids
      1 to 186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C21orf127
    • Chromosome 21 open reading frame 127
    • EC 2.1.1.-
    • HemK methyltransferase family member 2
    • HemK2
    • M.HsaHemK2P
    • MGC19995
    • MTQ2
    • N-6 adenine-specific DNA methyltransferase 1
    • N-6 adenine-specific DNA methyltransferase 1 (putative)
    • N6-DNA-methyltransferase
    • N6AMT
    • N6AMT1
    • OTTHUMP00000096393
    • OTTHUMP00000096394
    • PRED28
    see all
  • Relevance
    The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Images

  • ab162221 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up